Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries) |
Domain d1p3lg_: 1p3l G: [94038] Other proteins in same PDB: d1p3la_, d1p3lb_, d1p3ld_, d1p3le_, d1p3lf_, d1p3lh_ mutant |
PDB Entry: 1p3l (more details), 2.4 Å
SCOP Domain Sequences for d1p3lg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3lg_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]} rakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaa rdnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
Timeline for d1p3lg_: