| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (4 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries) |
| Domain d1p3lf_: 1p3l F: [94037] Other proteins in same PDB: d1p3la_, d1p3lc_, d1p3ld_, d1p3le_, d1p3lg_, d1p3lh_ |
PDB Entry: 1p3l (more details), 2.4 Å
SCOP Domain Sequences for d1p3lf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3lf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis)}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg
Timeline for d1p3lf_: