SCOP 1.73: Domain d1p3ke_: 1p3k E:

Lineage for d1p3ke_ (1p3k E:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (23 PDB entries)

8. Domain d1p3ke_: 1p3k E: [94028]
   Other proteins in same PDB: d1p3kb_, d1p3kc_, d1p3kd_, d1p3kf_, d1p3kg_, d1p3kh_
   mutant

Details for d1p3ke_

PDB Entry: 1p3k, 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

PDB Compounds: (E:) histone h3

SCOP Domain Sequences for d1p3ke_:

Sequence; same for both SEQRES and ATOM records:

>d1p3ke_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvaimpkdiqlarrirgera

Timeline for d1p3ke_:

• d1p3ke_ first appeared in SCOP 1.67
  
• d1p3ke_ appears in SCOP 1.71
  
• d1p3ke_ appears in SCOP 1.75
  
• d1p3ke_ appears in the current release, SCOPe 2.08