Lineage for d1p3kd_ (1p3k D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440192Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 440193Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 440194Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 440250Protein Histone H2B [47119] (3 species)
  7. 440251Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)
  8. 440280Domain d1p3kd_: 1p3k D: [94027]
    Other proteins in same PDB: d1p3ka_, d1p3kb_, d1p3kc_, d1p3ke_, d1p3kf_, d1p3kg_

Details for d1p3kd_

PDB Entry: 1p3k (more details), 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3kd_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
iqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1p3kd_:

Click to download the PDB-style file with coordinates for d1p3kd_.
(The format of our PDB-style files is described here.)

Timeline for d1p3kd_: