SCOPe 2.06: Domain d1p3ja2: 1p3j A:126-160

Lineage for d1p3ja2 (1p3j A:126-160)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families)
   automatically mapped to Pfam PF05191

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)

7. Species Bacillus subtilis [TaxId:1423] [103618] (1 PDB entry)

8. Domain d1p3ja2: 1p3j A:126-160 [94023]
   Other proteins in same PDB: d1p3ja1
   complexed with ap5, mg, zn

Details for d1p3ja2

PDB Entry: 1p3j, 1.9 Å

PDB Description: Adenylate Kinase from Bacillus subtilis

PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1p3ja2:

Sequence; same for both SEQRES and ATOM records:

>d1p3ja2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus subtilis [TaxId: 1423]}
grricsvcgttyhlvfnppktpgicdkdggelyqr

Timeline for d1p3ja2:

• d1p3ja2 first appeared in SCOP 1.67
  
• d1p3ja2 appears in SCOPe 2.05
  
• d1p3ja2 appears in SCOPe 2.07
  
• d1p3ja2 appears in the current release, SCOPe 2.08