Lineage for d1p3ja2 (1p3j A:126-160)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624629Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 624630Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 624631Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 624638Species Bacillus subtilis [TaxId:1423] [103618] (1 PDB entry)
  8. 624639Domain d1p3ja2: 1p3j A:126-160 [94023]
    Other proteins in same PDB: d1p3ja1
    complexed with ap5, mg, zn

Details for d1p3ja2

PDB Entry: 1p3j (more details), 1.9 Å

PDB Description: Adenylate Kinase from Bacillus subtilis

SCOP Domain Sequences for d1p3ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ja2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus subtilis}
grricsvcgttyhlvfnppktpgicdkdggelyqr

SCOP Domain Coordinates for d1p3ja2:

Click to download the PDB-style file with coordinates for d1p3ja2.
(The format of our PDB-style files is described here.)

Timeline for d1p3ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p3ja1