SCOPe 2.07: Domain d1p3ja1: 1p3j A:1-125,A:161-212

Lineage for d1p3ja1 (1p3j A:1-125,A:161-212)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (16 species)

7. Species Bacillus subtilis [TaxId:1423] [102341] (1 PDB entry)
   contains a zinc-finger subdomain, residues 126-160

8. Domain d1p3ja1: 1p3j A:1-125,A:161-212 [94022]
   Other proteins in same PDB: d1p3ja2
   complexed with ap5, mg, zn

Details for d1p3ja1

PDB Entry: 1p3j, 1.9 Å

PDB Description: Adenylate Kinase from Bacillus subtilis

PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1p3ja1:

Sequence; same for both SEQRES and ATOM records:

>d1p3ja1 c.37.1.1 (A:1-125,A:161-212) Adenylate kinase {Bacillus subtilis [TaxId: 1423]}
mnlvlmglpgagkgtqgerivedygiphistgdmfraamkeetplgleaksyidkgelvp
devtigivkerlgkddcergflldgfprtvaqaealeeileeygkpidyvinievdkdvl
merltXaddneetvskrlevnmkqtqplldfysekgylanvngqqdiqdvyadvkdll

Timeline for d1p3ja1:

• d1p3ja1 first appeared in SCOP 1.67
  
• d1p3ja1 appears in SCOPe 2.06
  
• d1p3ja1 appears in the current release, SCOPe 2.08