Lineage for d1p3ie_ (1p3i E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311654Protein Histone H3 [47122] (6 species)
  7. 2311655Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 2311667Domain d1p3ie_: 1p3i E: [94018]
    Other proteins in same PDB: d1p3ib_, d1p3ic_, d1p3id_, d1p3if_, d1p3ig_, d1p3ih_
    protein/DNA complex; mutant

Details for d1p3ie_

PDB Entry: 1p3i (more details), 2.3 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (E:) histone h3

SCOPe Domain Sequences for d1p3ie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ie_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
tgeskkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavma
lqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1p3ie_:

Click to download the PDB-style file with coordinates for d1p3ie_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ie_: