Lineage for d1p3ic_ (1p3i C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440192Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 440193Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 440194Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 440195Protein Histone H2A [47115] (4 species)
  7. 440196Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (19 PDB entries)
  8. 440203Domain d1p3ic_: 1p3i C: [94016]
    Other proteins in same PDB: d1p3ia_, d1p3ib_, d1p3id_, d1p3ie_, d1p3if_, d1p3ih_

Details for d1p3ic_

PDB Entry: 1p3i (more details), 2.3 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ic_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis)}
ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllp

SCOP Domain Coordinates for d1p3ic_:

Click to download the PDB-style file with coordinates for d1p3ic_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ic_: