Lineage for d1p3gh_ (1p3g H:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535113Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 535114Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 535115Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 535171Protein Histone H2B [47119] (3 species)
  7. 535172Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)
  8. 535196Domain d1p3gh_: 1p3g H: [94013]
    Other proteins in same PDB: d1p3ga_, d1p3gb_, d1p3gc_, d1p3ge_, d1p3gf_, d1p3gg_
    mutant

Details for d1p3gh_

PDB Entry: 1p3g (more details), 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3gh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3gh_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis)}
kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
iqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1p3gh_:

Click to download the PDB-style file with coordinates for d1p3gh_.
(The format of our PDB-style files is described here.)

Timeline for d1p3gh_: