Lineage for d1p3gb_ (1p3g B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 765074Protein Histone H4 [47125] (5 species)
  7. 765075Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)
  8. 765101Domain d1p3gb_: 1p3g B: [94007]
    Other proteins in same PDB: d1p3ga_, d1p3gc_, d1p3gd_, d1p3ge_, d1p3gg_, d1p3gh_

Details for d1p3gb_

PDB Entry: 1p3g (more details), 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (B:) histone h4

SCOP Domain Sequences for d1p3gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3gb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkeisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1p3gb_:

Click to download the PDB-style file with coordinates for d1p3gb_.
(The format of our PDB-style files is described here.)

Timeline for d1p3gb_: