SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1p3ga_ (1p3g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986712Protein Histone H3 [47122] (6 species)
  7. 1986713Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1986740Domain d1p3ga_: 1p3g A: [94006]
    Other proteins in same PDB: d1p3gb_, d1p3gc_, d1p3gd_, d1p3gf_, d1p3gg_, d1p3gh_
    protein/DNA complex; mutant

Details for d1p3ga_

PDB Entry: 1p3g (more details), 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d1p3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ga_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1p3ga_:

Click to download the PDB-style file with coordinates for d1p3ga_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ga_: