SCOP 1.73: Domain d1p3fh_: 1p3f H:

Lineage for d1p3fh_ (1p3f H:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (23 PDB entries)

8. Domain d1p3fh_: 1p3f H: [94005]
   Other proteins in same PDB: d1p3fa_, d1p3fb_, d1p3fc_, d1p3fe_, d1p3ff_, d1p3fg_
   mutant

Details for d1p3fh_

PDB Entry: 1p3f, 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

PDB Compounds: (H:) histone h2b

SCOP Domain Sequences for d1p3fh_:

Sequence; same for both SEQRES and ATOM records:

>d1p3fh_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ksrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1p3fh_:

• d1p3fh_ first appeared in SCOP 1.67
  
• d1p3fh_ appears in SCOP 1.71
  
• d1p3fh_ appears in SCOP 1.75
  
• d1p3fh_ appears in the current release, SCOPe 2.08