Lineage for d1p3fe_ (1p3f E:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764992Protein Histone H3 [47122] (5 species)
  7. 764993Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (27 PDB entries)
  8. 765039Domain d1p3fe_: 1p3f E: [94002]
    Other proteins in same PDB: d1p3fb_, d1p3fc_, d1p3fd_, d1p3ff_, d1p3fg_, d1p3fh_
    mutant

Details for d1p3fe_

PDB Entry: 1p3f (more details), 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (E:) histone h3

SCOP Domain Sequences for d1p3fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3fe_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1p3fe_:

Click to download the PDB-style file with coordinates for d1p3fe_.
(The format of our PDB-style files is described here.)

Timeline for d1p3fe_: