SCOPe 2.04: Domain d1p3ea_: 1p3e A:

Lineage for d1p3ea_ (1p3e A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Glutamyl endopeptidase [101811] (1 species)

7. Species Bacillus intermedius [TaxId:1400] [101812] (2 PDB entries)

8. Domain d1p3ea_: 1p3e A: [93997]
   complexed with mpd

Details for d1p3ea_

PDB Entry: 1p3e, 1.72 Å

PDB Description: Structure of Glu endopeptidase in complex with MPD

PDB Compounds: (A:) glutamyl-endopeptidase

SCOPe Domain Sequences for d1p3ea_:

Sequence; same for both SEQRES and ATOM records:

>d1p3ea_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]}
vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak
gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt
nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq
qivgvhnagysngtinggpkataafvefinyakaq

Timeline for d1p3ea_:

• d1p3ea_ first appeared in SCOP 1.67
  
• d1p3ea_ appears in SCOPe 2.03
  
• d1p3ea_ appears in SCOPe 2.05
  
• d1p3ea_ appears in the current release, SCOPe 2.08