![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins) |
![]() | Protein Glutamyl endopeptidase [101811] (1 species) |
![]() | Species Bacillus intermedius [TaxId:1400] [101812] (2 PDB entries) |
![]() | Domain d1p3ea_: 1p3e A: [93997] |
PDB Entry: 1p3e (more details), 1.72 Å
SCOP Domain Sequences for d1p3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3ea_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius} vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq qivgvhnagysngtinggpkataafvefinyakaq
Timeline for d1p3ea_: