Lineage for d1p3ea_ (1p3e A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 376041Family b.47.1.1: Prokaryotic proteases [50495] (13 proteins)
  6. 376103Protein Glutamyl endopeptidase [101811] (1 species)
  7. 376104Species Bacillus intermedius [TaxId:1400] [101812] (2 PDB entries)
  8. 376106Domain d1p3ea_: 1p3e A: [93997]
    complexed with mpd

Details for d1p3ea_

PDB Entry: 1p3e (more details), 1.72 Å

PDB Description: Structure of Glu endopeptidase in complex with MPD

SCOP Domain Sequences for d1p3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ea_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius}
vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak
gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt
nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq
qivgvhnagysngtinggpkataafvefinyakaq

SCOP Domain Coordinates for d1p3ea_:

Click to download the PDB-style file with coordinates for d1p3ea_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ea_: