SCOP 1.71: Domain d1p3ca_: 1p3c A:

Lineage for d1p3ca_ (1p3c A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins)

6. Protein Glutamyl endopeptidase [101811] (1 species)

7. Species Bacillus intermedius [TaxId:1400] [101812] (2 PDB entries)

8. Domain d1p3ca_: 1p3c A: [93996]

Details for d1p3ca_

PDB Entry: 1p3c, 1.5 Å

PDB Description: Glutamyl endopeptidase from Bacillus intermedius

SCOP Domain Sequences for d1p3ca_:

Sequence; same for both SEQRES and ATOM records:

>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius}
vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak
gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt
nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq
qivgvhnagysngtinggpkataafvefinyakaq

Timeline for d1p3ca_:

• d1p3ca_ first appeared in SCOP 1.67
  
• d1p3ca_ appears in SCOP 1.69
  
• d1p3ca_ appears in SCOP 1.73
  
• d1p3ca_ appears in the current release, SCOPe 2.08