Lineage for d1p3ca_ (1p3c A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465073Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins)
  6. 465135Protein Glutamyl endopeptidase [101811] (1 species)
  7. 465136Species Bacillus intermedius [TaxId:1400] [101812] (2 PDB entries)
  8. 465137Domain d1p3ca_: 1p3c A: [93996]

Details for d1p3ca_

PDB Entry: 1p3c (more details), 1.5 Å

PDB Description: Glutamyl endopeptidase from Bacillus intermedius

SCOP Domain Sequences for d1p3ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius}
vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak
gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt
nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq
qivgvhnagysngtinggpkataafvefinyakaq

SCOP Domain Coordinates for d1p3ca_:

Click to download the PDB-style file with coordinates for d1p3ca_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ca_: