SCOPe 2.06: Domain d1p3bh_: 1p3b H:

Lineage for d1p3bh_ (1p3b H:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (39 PDB entries)

8. Domain d1p3bh_: 1p3b H: [93995]
   Other proteins in same PDB: d1p3ba_, d1p3bb_, d1p3bc_, d1p3be_, d1p3bf_, d1p3bg_
   protein/DNA complex; mutant

Details for d1p3bh_

PDB Entry: 1p3b, 3 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

PDB Compounds: (H:) histone h2b

SCOPe Domain Sequences for d1p3bh_:

Sequence; same for both SEQRES and ATOM records:

>d1p3bh_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
iqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1p3bh_:

• d1p3bh_ first appeared in SCOP 1.67
  
• d1p3bh_ appears in SCOPe 2.05
  
• d1p3bh_ appears in SCOPe 2.07
  
• d1p3bh_ appears in the current release, SCOPe 2.08