Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (5 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries) |
Domain d1p3bb_: 1p3b B: [93989] Other proteins in same PDB: d1p3ba_, d1p3bc_, d1p3bd_, d1p3be_, d1p3bg_, d1p3bh_ |
PDB Entry: 1p3b (more details), 3 Å
SCOP Domain Sequences for d1p3bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3bb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} niqgitkpairrlarrggvkaisgliyeetrgvlkvflenvirdavtytehakrktvtam dvvyalkrqgrtlygfgg
Timeline for d1p3bb_: