Lineage for d1p3ba_ (1p3b A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440192Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 440193Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 440194Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 440304Protein Histone H3 [47122] (3 species)
  7. 440305Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries)
  8. 440344Domain d1p3ba_: 1p3b A: [93988]
    Other proteins in same PDB: d1p3bb_, d1p3bc_, d1p3bd_, d1p3bf_, d1p3bg_, d1p3bh_

Details for d1p3ba_

PDB Entry: 1p3b (more details), 3 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ba_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis)}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1p3ba_:

Click to download the PDB-style file with coordinates for d1p3ba_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ba_: