Lineage for d1p34g_ (1p34 G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987255Protein Histone H2A [47115] (6 species)
  7. 1987256Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (34 PDB entries)
  8. 1987284Domain d1p34g_: 1p34 G: [93976]
    Other proteins in same PDB: d1p34a_, d1p34b_, d1p34d_, d1p34e_, d1p34f_, d1p34h_
    protein/DNA complex; mutant

Details for d1p34g_

PDB Entry: 1p34 (more details), 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (G:) histone h2a

SCOPe Domain Sequences for d1p34g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p34g_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk

SCOPe Domain Coordinates for d1p34g_:

Click to download the PDB-style file with coordinates for d1p34g_.
(The format of our PDB-style files is described here.)

Timeline for d1p34g_: