SCOPe 2.07: Domain d1p34c_: 1p34 C:

Lineage for d1p34c_ (1p34 C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries)

8. Domain d1p34c_: 1p34 C: [93972]
   Other proteins in same PDB: d1p34a_, d1p34b_, d1p34d_, d1p34e_, d1p34f_, d1p34h_
   protein/DNA complex; mutant

Details for d1p34c_

PDB Entry: 1p34, 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

PDB Compounds: (C:) histone h2a

SCOPe Domain Sequences for d1p34c_:

Sequence; same for both SEQRES and ATOM records:

>d1p34c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

Timeline for d1p34c_:

• d1p34c_ first appeared in SCOP 1.67
  
• d1p34c_ appears in SCOPe 2.06
  
• d1p34c_ appears in the current release, SCOPe 2.08