Lineage for d1p34c_ (1p34 C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637444Protein Histone H2A [47115] (5 species)
  7. 637445Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (20 PDB entries)
  8. 637464Domain d1p34c_: 1p34 C: [93972]
    Other proteins in same PDB: d1p34a_, d1p34b_, d1p34d_, d1p34e_, d1p34f_, d1p34h_

Details for d1p34c_

PDB Entry: 1p34 (more details), 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (C:) histone h2a

SCOP Domain Sequences for d1p34c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p34c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOP Domain Coordinates for d1p34c_:

Click to download the PDB-style file with coordinates for d1p34c_.
(The format of our PDB-style files is described here.)

Timeline for d1p34c_: