| Class b: All beta proteins [48724] (180 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) ![]() duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
| Family b.121.2.2: Adenovirus hexon [49753] (3 proteins) each domain is heavily decorated with many insertions |
| Protein Adenovirus hexon, C-terminal domain [418931] (2 species) |
| Species Human adenovirus type 5 [TaxId:28285] [419365] (3 PDB entries) |
| Domain d1p30a2: 1p30 A:637-946 [93965] Other proteins in same PDB: d1p30a1 |
PDB Entry: 1p30 (more details), 2.5 Å
SCOPe Domain Sequences for d1p30a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p30a2 b.121.2.2 (A:637-946) Adenovirus hexon, C-terminal domain {Human adenovirus type 5 [TaxId: 28285]}
tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp
yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva
qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv
gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss
nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie
tvylrtpfsa
Timeline for d1p30a2: