Lineage for d1p30a1 (1p30 A:5-636)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075469Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2075491Family b.121.2.2: Adenovirus hexon [49753] (2 protein domains)
    each domain is heavily decorated with many insertions
  6. 2075492Protein Adenovirus hexon [63404] (2 species)
  7. 2075496Species Human adenovirus type 5 [TaxId:28285] [49756] (3 PDB entries)
  8. 2075499Domain d1p30a1: 1p30 A:5-636 [93964]

Details for d1p30a1

PDB Entry: 1p30 (more details), 2.5 Å

PDB Description: refinement of adenovirus type 5 hexon with cns
PDB Compounds: (A:) hexon protein

SCOPe Domain Sequences for d1p30a1:

Sequence, based on SEQRES records: (download)

>d1p30a1 b.121.2.2 (A:5-636) Adenovirus hexon {Human adenovirus type 5 [TaxId: 28285]}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitkegiq
igvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakptneng
gqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthisympt
ikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdlqdrn
telsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvintet
ltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialylpdkl
kyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnaglry
rsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrvdg
asikfdsiclyatffpmahntastleamlrnd

Sequence, based on observed residues (ATOM records): (download)

>d1p30a1 b.121.2.2 (A:5-636) Adenovirus hexon {Human adenovirus type 5 [TaxId: 28285]}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesqwyet
einhaagrvlkkttpmkpcygsyakptnenggqgilvlesqvemqffstteltpkvvlys
edvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvl
agqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgted
elpnycfplggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysn
ialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfn
hhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqss
lgndlrvdgasikfdsiclyatffpmahntastleamlrnd

SCOPe Domain Coordinates for d1p30a1:

Click to download the PDB-style file with coordinates for d1p30a1.
(The format of our PDB-style files is described here.)

Timeline for d1p30a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p30a2