Lineage for d1p2za2 (1p2z A:651-962)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812279Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 1812301Family b.121.2.2: Adenovirus hexon [49753] (1 protein)
    each domain is heavily decorated with many insertions
  6. 1812302Protein Adenovirus hexon [63404] (2 species)
  7. 1812303Species Human adenovirus type 2 [TaxId:10515] [49755] (1 PDB entry)
  8. 1812305Domain d1p2za2: 1p2z A:651-962 [93963]
    complexed with cit

Details for d1p2za2

PDB Entry: 1p2z (more details), 2.2 Å

PDB Description: refinement of adenovirus type 2 hexon with cns
PDB Compounds: (A:) hexon protein

SCOPe Domain Sequences for d1p2za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2za2 b.121.2.2 (A:651-962) Adenovirus hexon {Human adenovirus type 2 [TaxId: 10515]}
ndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgy
dpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegyn
vaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykeyq
qvgilhqhnnsgfvgylaptmregqaypanvpypligktavdsitqkkflcdrtlwripf
ssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhqphrgv
ietvylrtpfsa

SCOPe Domain Coordinates for d1p2za2:

Click to download the PDB-style file with coordinates for d1p2za2.
(The format of our PDB-style files is described here.)

Timeline for d1p2za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p2za1