Lineage for d1p2qc_ (1p2q C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2055878Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2055879Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
    Uniprot P00766
  8. 2055903Domain d1p2qc_: 1p2q C: [93954]
    Other proteins in same PDB: d1p2qb_, d1p2qd_
    complexed with so4, trs

Details for d1p2qc_

PDB Entry: 1p2q (more details), 1.8 Å

PDB Description: Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
PDB Compounds: (C:) chymotrypsinogen a

SCOPe Domain Sequences for d1p2qc_:

Sequence, based on SEQRES records: (download)

>d1p2qc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1p2qc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d1p2qc_:

Click to download the PDB-style file with coordinates for d1p2qc_.
(The format of our PDB-style files is described here.)

Timeline for d1p2qc_: