SCOP 1.75: Domain d1p2ka_: 1p2k A:

Lineage for d1p2ka_ (1p2k A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
   Uniprot P00760

8. Domain d1p2ka_: 1p2k A: [93937]
   Other proteins in same PDB: d1p2ki_
   complexed with ca, so4; mutant

Details for d1p2ka_

PDB Entry: 1p2k, 1.6 Å

PDB Description: structural consequences of accommodation of four non-cognate amino- acid residues in the s1 pocket of bovine trypsin and chymotrypsin

PDB Compounds: (A:) trypsinogen, cationic

SCOP Domain Sequences for d1p2ka_:

Sequence; same for both SEQRES and ATOM records:

>d1p2ka_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1p2ka_:

• d1p2ka_ first appeared in SCOP 1.67
  
• d1p2ka_ appears in SCOP 1.73
  
• d1p2ka_ appears in SCOPe 2.01
  
• d1p2ka_ appears in the current release, SCOPe 2.08