Lineage for d1p2ja_ (1p2j A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 376157Family b.47.1.2: Eukaryotic proteases [50514] (44 protein domains)
  6. 376749Protein Trypsin(ogen) [50515] (8 species)
  7. 376750Species Cow (Bos taurus) [TaxId:9913] [50516] (213 PDB entries)
  8. 376758Domain d1p2ja_: 1p2j A: [93935]
    Other proteins in same PDB: d1p2ji_
    complexed with ca, so4; mutant

Details for d1p2ja_

PDB Entry: 1p2j (more details), 1.35 Å

PDB Description: Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin

SCOP Domain Sequences for d1p2ja_:

Sequence, based on SEQRES records: (download)

>d1p2ja_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records): (download)

>d1p2ja_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslvasislptscasagtqclisgwgn
tkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvvc
sgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1p2ja_:

Click to download the PDB-style file with coordinates for d1p2ja_.
(The format of our PDB-style files is described here.)

Timeline for d1p2ja_: