Lineage for d1p2ea3 (1p2e A:360-505)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607180Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2607181Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2607182Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2607189Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
    contains additional N-terminal multiheme domain
  7. 2607190Species Shewanella frigidimarina [TaxId:56812] [56433] (16 PDB entries)
  8. 2607209Domain d1p2ea3: 1p2e A:360-505 [93928]
    Other proteins in same PDB: d1p2ea1, d1p2ea2
    complexed with acy, fad, fum, hem, na; mutant

Details for d1p2ea3

PDB Entry: 1p2e (more details), 2.2 Å

PDB Description: h61a mutant of flavocytochrome c3
PDB Compounds: (A:) flavocytochrome c3

SCOPe Domain Sequences for d1p2ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2ea3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
qyiqahptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksayl
ifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtd
ferpnlpralnegnyyaievtpgvhh

SCOPe Domain Coordinates for d1p2ea3:

Click to download the PDB-style file with coordinates for d1p2ea3.
(The format of our PDB-style files is described here.)

Timeline for d1p2ea3: