Lineage for d1p2cb2 (1p2c B:414-516)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655419Domain d1p2cb2: 1p2c B:414-516 [93918]
    Other proteins in same PDB: d1p2ca1, d1p2ca2, d1p2cb1, d1p2cc_, d1p2cd1, d1p2cd2, d1p2ce1, d1p2cf_

Details for d1p2cb2

PDB Entry: 1p2c (more details), 2 Å

PDB Description: crystal structure analysis of an anti-lysozyme antibody
PDB Compounds: (B:) heavy chain VH+CH1 anti-lysozyme antibody F10.6.6

SCOP Domain Sequences for d1p2cb2:

Sequence, based on SEQRES records: (download)

>d1p2cb2 b.1.1.2 (B:414-516) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
vssasttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
qsdlytlsssvtvpsspwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1p2cb2 b.1.1.2 (B:414-516) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
vssasttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsspwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1p2cb2:

Click to download the PDB-style file with coordinates for d1p2cb2.
(The format of our PDB-style files is described here.)

Timeline for d1p2cb2: