Lineage for d1p2cb2 (1p2c B:414-516)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365207Domain d1p2cb2: 1p2c B:414-516 [93918]
    Other proteins in same PDB: d1p2ca1, d1p2ca2, d1p2cb1, d1p2cc_, d1p2cd1, d1p2cd2, d1p2ce1, d1p2cf_

Details for d1p2cb2

PDB Entry: 1p2c (more details), 2 Å

PDB Description: crystal structure analysis of an anti-lysozyme antibody

SCOP Domain Sequences for d1p2cb2:

Sequence, based on SEQRES records: (download)

>d1p2cb2 b.1.1.2 (B:414-516) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
vssasttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
qsdlytlsssvtvpsspwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1p2cb2 b.1.1.2 (B:414-516) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
vssasttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsspwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1p2cb2:

Click to download the PDB-style file with coordinates for d1p2cb2.
(The format of our PDB-style files is described here.)

Timeline for d1p2cb2: