SCOP 1.71: Domain d1p2cb1: 1p2c B:301-413

Lineage for d1p2cb1 (1p2c B:301-413)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1p2cb1: 1p2c B:301-413 [93917]
   Other proteins in same PDB: d1p2ca1, d1p2ca2, d1p2cb2, d1p2cc_, d1p2cd1, d1p2cd2, d1p2ce2, d1p2cf_

Details for d1p2cb1

PDB Entry: 1p2c, 2 Å

PDB Description: crystal structure analysis of an anti-lysozyme antibody

SCOP Domain Sequences for d1p2cb1:

Sequence; same for both SEQRES and ATOM records:

>d1p2cb1 b.1.1.1 (B:301-413) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqesgaelmkpgasvkisckatgytfttywiewikqrpghslewigeilpgsdstyy
nekvkgkvtftadassntaymqlssltsedsavyycargdgfyvywgqgttlt

Timeline for d1p2cb1:

• d1p2cb1 first appeared in SCOP 1.67
  
• d1p2cb1 appears in SCOP 1.69
  
• d1p2cb1 appears in SCOP 1.73
  
• d1p2cb1 appears in the current release, SCOPe 2.08