SCOP 1.67: Domain d1p28a_: 1p28 A:

Lineage for d1p28a_ (1p28 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)

6. Protein Pheromone binding protein PBPLma [101188] (1 species)

7. Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)

8. Domain d1p28a_: 1p28 A: [93911]

Details for d1p28a_

PDB Entry: 1p28, 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with a component of the pheromonal blend: 3-hydroxy-butan-2-one.

SCOP Domain Sequences for d1p28a_:

Sequence; same for both SEQRES and ATOM records:

>d1p28a_ a.39.2.1 (A:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae)}
nsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispe
gaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrns

Timeline for d1p28a_:

• d1p28a_ is new in SCOP 1.67
  
• d1p28a_ appears in SCOP 1.69
  
• d1p28a_ appears in the current release, SCOPe 2.08, called d1p28a1