| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.232: Mago nashi protein [89816] (1 superfamily) beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234 |
Superfamily d.232.1: Mago nashi protein [89817] (1 family) ![]() automatically mapped to Pfam PF02792 |
| Family d.232.1.1: Mago nashi protein [89818] (1 protein) |
| Protein Mago nashi protein [89819] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries) |
| Domain d1p27c_: 1p27 C: [93909] Other proteins in same PDB: d1p27b_, d1p27d_ protein/RNA complex |
PDB Entry: 1p27 (more details), 2 Å
SCOPe Domain Sequences for d1p27c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p27c_ d.232.1.1 (C:) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
esdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelk
riiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrv
fyylvqdlkclvfsliglhfkikp
Timeline for d1p27c_: