Lineage for d1p1za2 (1p1z A:3-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938107Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2938187Domain d1p1za2: 1p1z A:3-181 [93904]
    Other proteins in same PDB: d1p1za1, d1p1zb_, d1p1zd_

Details for d1p1za2

PDB Entry: 1p1z (more details), 3.26 Å

PDB Description: x-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1p1za2:

Sequence, based on SEQRES records: (download)

>d1p1za2 d.19.1.1 (A:3-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
hslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatllr

Sequence, based on observed residues (ATOM records): (download)

>d1p1za2 d.19.1.1 (A:3-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
hslryfvtavsrpglgeprymevgyvddtefvyeprarwmeqegpeyweretqkakgneq
sfrvdlrtllgyynqskggshtiqvisgcevrgyqqyaydgcdyialnedlktwtaadma
alitkhkweqageaerlraylegtcvewlrrylkngnatllr

SCOPe Domain Coordinates for d1p1za2:

Click to download the PDB-style file with coordinates for d1p1za2.
(The format of our PDB-style files is described here.)

Timeline for d1p1za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1za1