Lineage for d1p1za1 (1p1z A:182-274)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349424Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2349724Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2349911Domain d1p1za1: 1p1z A:182-274 [93903]
    Other proteins in same PDB: d1p1za2, d1p1zb_, d1p1zd_

Details for d1p1za1

PDB Entry: 1p1z (more details), 3.26 Å

PDB Description: x-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1p1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1za1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d1p1za1:

Click to download the PDB-style file with coordinates for d1p1za1.
(The format of our PDB-style files is described here.)

Timeline for d1p1za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1za2