SCOP 1.75: Domain d1p1vc_: 1p1v C:

Lineage for d1p1vc_ (1p1v C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (27 PDB entries)

8. Domain d1p1vc_: 1p1v C: [93902]
   complexed with so4, zn; mutant

Details for d1p1vc_

PDB Entry: 1p1v, 1.4 Å

PDB Description: crystal structure of fals-associated human copper-zinc superoxide dismutase (cuznsod) mutant d125h to 1.4a

PDB Compounds: (C:) Superoxide dismutase [Cu-Zn]

SCOP Domain Sequences for d1p1vc_:

Sequence, based on SEQRES records:

>d1p1vc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekadhlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d1p1vc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekadhlgkktgnagsrlacgvigiaq

Timeline for d1p1vc_:

• d1p1vc_ first appeared in SCOP 1.67
  
• d1p1vc_ appears in SCOP 1.73
  
• d1p1vc_ appears in SCOPe 2.01
  
• d1p1vc_ appears in the current release, SCOPe 2.08