Lineage for d1p1vb_ (1p1v B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2373698Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2373801Species Human (Homo sapiens) [TaxId:9606] [49333] (95 PDB entries)
  8. 2373830Domain d1p1vb_: 1p1v B: [93901]
    complexed with so4, zn; mutant

Details for d1p1vb_

PDB Entry: 1p1v (more details), 1.4 Å

PDB Description: crystal structure of fals-associated human copper-zinc superoxide dismutase (cuznsod) mutant d125h to 1.4a
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1p1vb_:

Sequence, based on SEQRES records: (download)

>d1p1vb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekadhlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records): (download)

>d1p1vb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekadhlgtgnagsrlacgvigiaq

SCOPe Domain Coordinates for d1p1vb_:

Click to download the PDB-style file with coordinates for d1p1vb_.
(The format of our PDB-style files is described here.)

Timeline for d1p1vb_: