Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (6 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
Protein Glutamate receptor interacting protein [82083] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [82084] (3 PDB entries) |
Domain d1p1da1: 1p1d A:18-114 [93896] first and second PDZ domains |
PDB Entry: 1p1d (more details)
SCOP Domain Sequences for d1p1da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p1da1 b.36.1.1 (A:18-114) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} qvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaercgvlqigdr vmaingiptedstfeeanqllrdssitskvtleiefd
Timeline for d1p1da1: