Lineage for d1p1da1 (1p1d A:18-114)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 797845Protein Glutamate receptor interacting protein [82083] (2 species)
  7. 797848Species Rat (Rattus norvegicus) [TaxId:10116] [82084] (3 PDB entries)
  8. 797850Domain d1p1da1: 1p1d A:18-114 [93896]
    first and second PDZ domains

Details for d1p1da1

PDB Entry: 1p1d (more details)

PDB Description: structural insights into the inter-domain chaperoning of tandem pdz domains in glutamate receptor interacting proteins
PDB Compounds: (A:) Glutamate receptor interacting protein

SCOP Domain Sequences for d1p1da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1da1 b.36.1.1 (A:18-114) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}
qvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaercgvlqigdr
vmaingiptedstfeeanqllrdssitskvtleiefd

SCOP Domain Coordinates for d1p1da1:

Click to download the PDB-style file with coordinates for d1p1da1.
(The format of our PDB-style files is described here.)

Timeline for d1p1da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1da2