Lineage for d1p15a_ (1p15 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486243Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 486244Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 486283Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 486284Protein Protein-tyrosine phosphatase alpha [102420] (1 species)
  7. 486285Species Mouse (Mus musculus) [TaxId:10090] [102421] (1 PDB entry)
  8. 486286Domain d1p15a_: 1p15 A: [93894]

Details for d1p15a_

PDB Entry: 1p15 (more details), 2 Å

PDB Description: Crystal structure of the D2 domain of RPTPa

SCOP Domain Sequences for d1p15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus)}
mrtgnlpanmkknrvlqiipyefnrviipvkrgeentdyvnasfidgyrqkdsyiasqgp
llhtiedfwrmiwewkscsivmlteleergqekcaqywpsdglvsygditvelkkeeece
sytvrdllvtntrenksrqirqfhfhgwpevgipsdgkgminiiaavqkqqqqsgnhpit
vhcsagagrtgtfcalstvlervkaegildvfqtvkslrlqrphmvqtleqyefcykvvq
eyida

SCOP Domain Coordinates for d1p15a_:

Click to download the PDB-style file with coordinates for d1p15a_.
(The format of our PDB-style files is described here.)

Timeline for d1p15a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p15b_