![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
![]() | Protein Protein-tyrosine phosphatase alpha [102420] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [102421] (1 PDB entry) |
![]() | Domain d1p15a_: 1p15 A: [93894] D2 domain |
PDB Entry: 1p15 (more details), 2 Å
SCOPe Domain Sequences for d1p15a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} mrtgnlpanmkknrvlqiipyefnrviipvkrgeentdyvnasfidgyrqkdsyiasqgp llhtiedfwrmiwewkscsivmlteleergqekcaqywpsdglvsygditvelkkeeece sytvrdllvtntrenksrqirqfhfhgwpevgipsdgkgminiiaavqkqqqqsgnhpit vhcsagagrtgtfcalstvlervkaegildvfqtvkslrlqrphmvqtleqyefcykvvq eyida
Timeline for d1p15a_: