Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein c-src tyrosine kinase [55556] (3 species) |
Domain d1p13a_: 1p13 A: [93892] complexed with peptide, chains C and D complexed with cac |
PDB Entry: 1p13 (more details), 1.63 Å
SCOPe Domain Sequences for d1p13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p13a_ d.93.1.1 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcp
Timeline for d1p13a_: