Lineage for d1p0zi_ (1p0z I:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038349Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 1038350Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)
  6. 1038354Protein Sensor kinase CitA [103192] (1 species)
    citrate-binding domain
  7. 1038355Species Klebsiella pneumoniae [TaxId:573] [103193] (1 PDB entry)
  8. 1038364Domain d1p0zi_: 1p0z I: [93890]
    complexed with flc, mo7, na, omo

Details for d1p0zi_

PDB Entry: 1p0z (more details), 1.6 Å

PDB Description: Sensor Kinase CitA binding domain
PDB Compounds: (I:) Sensor kinase citA

SCOPe Domain Sequences for d1p0zi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0zi_ d.110.6.1 (I:) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]}
eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
vgytieqlehh

SCOPe Domain Coordinates for d1p0zi_:

Click to download the PDB-style file with coordinates for d1p0zi_.
(The format of our PDB-style files is described here.)

Timeline for d1p0zi_: