Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (3 families) alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (2 proteins) |
Protein Sensor kinase CitA [103192] (1 species) citrate-binding domain |
Species Klebsiella pneumoniae [TaxId:573] [103193] (3 PDB entries) |
Domain d1p0zh_: 1p0z H: [93889] |
PDB Entry: 1p0z (more details), 1.6 Å
SCOP Domain Sequences for d1p0zh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0zh_ d.110.6.1 (H:) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]} eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs vgytieqlehh
Timeline for d1p0zh_: