Lineage for d1p0zg_ (1p0z G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1923012Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 1923013Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)
  6. 1923017Protein Sensor kinase CitA [103192] (1 species)
    citrate-binding domain
  7. 1923018Species Klebsiella pneumoniae [TaxId:573] [103193] (1 PDB entry)
  8. 1923025Domain d1p0zg_: 1p0z G: [93888]
    complexed with flc, mo7, na, omo

Details for d1p0zg_

PDB Entry: 1p0z (more details), 1.6 Å

PDB Description: Sensor Kinase CitA binding domain
PDB Compounds: (G:) Sensor kinase citA

SCOPe Domain Sequences for d1p0zg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0zg_ d.110.6.1 (G:) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]}
eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
vgytieqlehh

SCOPe Domain Coordinates for d1p0zg_:

Click to download the PDB-style file with coordinates for d1p0zg_.
(The format of our PDB-style files is described here.)

Timeline for d1p0zg_: