![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (3 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins) |
![]() | Protein Sensor kinase CitA [103192] (1 species) citrate-binding domain |
![]() | Species Klebsiella pneumoniae [TaxId:573] [103193] (1 PDB entry) |
![]() | Domain d1p0ze_: 1p0z E: [93886] complexed with flc, mo7, na, omo |
PDB Entry: 1p0z (more details), 1.6 Å
SCOPe Domain Sequences for d1p0ze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0ze_ d.110.6.1 (E:) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]} eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs vgytieqlehh
Timeline for d1p0ze_: