Lineage for d1p0za1 (1p0z A:5-133)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970928Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)
  6. 2970932Protein Sensor kinase CitA [103192] (1 species)
    citrate-binding domain
  7. 2970933Species Klebsiella pneumoniae [TaxId:573] [103193] (1 PDB entry)
  8. 2970934Domain d1p0za1: 1p0z A:5-133 [93882]
    Other proteins in same PDB: d1p0za2, d1p0zb2, d1p0zc2, d1p0zd2, d1p0ze2, d1p0zf2, d1p0zg2, d1p0zh2, d1p0zi2, d1p0zj2
    complexed with flc, mo7, na, omo

Details for d1p0za1

PDB Entry: 1p0z (more details), 1.6 Å

PDB Description: Sensor Kinase CitA binding domain
PDB Compounds: (A:) Sensor kinase citA

SCOPe Domain Sequences for d1p0za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0za1 d.110.6.1 (A:5-133) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]}
eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
vgytieqle

SCOPe Domain Coordinates for d1p0za1:

Click to download the PDB-style file with coordinates for d1p0za1.
(The format of our PDB-style files is described here.)

Timeline for d1p0za1: