![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins) |
![]() | Protein Sensor kinase CitA [103192] (1 species) citrate-binding domain |
![]() | Species Klebsiella pneumoniae [TaxId:573] [103193] (1 PDB entry) |
![]() | Domain d1p0za1: 1p0z A:5-133 [93882] Other proteins in same PDB: d1p0za2, d1p0zb2, d1p0zc2, d1p0zd2, d1p0ze2, d1p0zf2, d1p0zg2, d1p0zh2, d1p0zi2, d1p0zj2 complexed with flc, mo7, na, omo |
PDB Entry: 1p0z (more details), 1.6 Å
SCOPe Domain Sequences for d1p0za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0za1 d.110.6.1 (A:5-133) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]} eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs vgytieqle
Timeline for d1p0za1: